(data stored in ACNUC7421 zone)

EMBL: BA000030.PE303

BA000030.PE303       Location/Qualifiers
FT   CDS             352678..353949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_301"
FT                   /old_locus_tag="SAV_301"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_301"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68010"
FT                   /db_xref="GOA:Q82R43"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:Q82R43"
FT                   /protein_id="BAC68010.1"
FT                   /translation="MRCWPARCPASCPVFGVDVSVWVRSDAECSPGRGYYYHPSRHSAG
FT                   QPIVAGWAYSWLVGLELKTNSWTAPVDARRLVPGENPNTVAARQIRGLLQQSPELCLQA
FT                   PLFVFDDGYDSVRPALELTAVPAQILVRVRSDRSFYADPPPRRRTAAGRPRRHGAKFAC
FT                   PDPTTWPAPGRRPHVHGRAVRSSDRADVAPPARQDPAARRPRQPRPRPIIPGTLVRLTV
FT                   DRLPGRNRAPKTLWLWWTEPPGHTPDPDLLWRAYTRRFDVEHTFRFARQTLNWTLPRPR
FT                   TPEQADRWTWLVIAAYTQLRLARTLVADHRLPWEKPLPPARLTPGRVRRRFRHVQAVVG
FT                   TPANPPQPCGRSAGRPPARARTPPPRSQNSRKTRDSPPAGIKAKLRHSRRRDARSWLAE
FT                   RNKSRPRGGCRVEAFSLQRSMEPP"
     MRCWPARCPA SCPVFGVDVS VWVRSDAECS PGRGYYYHPS RHSAGQPIVA GWAYSWLVGL        60
     ELKTNSWTAP VDARRLVPGE NPNTVAARQI RGLLQQSPEL CLQAPLFVFD DGYDSVRPAL       120
     ELTAVPAQIL VRVRSDRSFY ADPPPRRRTA AGRPRRHGAK FACPDPTTWP APGRRPHVHG       180
     RAVRSSDRAD VAPPARQDPA ARRPRQPRPR PIIPGTLVRL TVDRLPGRNR APKTLWLWWT       240
     EPPGHTPDPD LLWRAYTRRF DVEHTFRFAR QTLNWTLPRP RTPEQADRWT WLVIAAYTQL       300
     RLARTLVADH RLPWEKPLPP ARLTPGRVRR RFRHVQAVVG TPANPPQPCG RSAGRPPARA       360
     RTPPPRSQNS RKTRDSPPAG IKAKLRHSRR RDARSWLAER NKSRPRGGCR VEAFSLQRSM       420
     EPP                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page