(data stored in ACNUC7421 zone)

EMBL: BA000030.PE306

BA000030.PE306       Location/Qualifiers
FT   CDS             complement(355951..357105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_304"
FT                   /old_locus_tag="SAV_304"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_304"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68013"
FT                   /db_xref="GOA:Q82R40"
FT                   /db_xref="InterPro:IPR010645"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q82R40"
FT                   /protein_id="BAC68013.1"
FT                   /translation="MIDTPIRTYIAQHTDGLAVSGSAVYAFWQAVGLFGLVGGFFHSTG
FT                   ARITYSLWGAASVGMVWSASPADGRTVATGIAVLAWTIASVFALRGLSLRPVIHTAFQP
FT                   HIALLGIAAPALLRSTAALRTGLLVLAASLSLMPLTHDSGAWWALRLIAGAASALVFMI
FT                   ATSAMLAGLAAHMTGWAFGGVGAGIALSGLMVVAVQQAGSWQTAWFACAVLTVLLTVAA
FT                   WNLVPRGAAATAPAATAAAERPRTHRWFTALLTSYVLEGIGYIIAGTFLVAALQQGAPG
FT                   WIGSGAWIVVGLAALPSCAVWMRLARLHRTHETPGHNHNLRSLPNPGCLCVLSSPMGRE
FT                   GLGFSLVGDHDAPHVVGQAAFQAPLRFLRRLTLREFALVVRVSG"
     MIDTPIRTYI AQHTDGLAVS GSAVYAFWQA VGLFGLVGGF FHSTGARITY SLWGAASVGM        60
     VWSASPADGR TVATGIAVLA WTIASVFALR GLSLRPVIHT AFQPHIALLG IAAPALLRST       120
     AALRTGLLVL AASLSLMPLT HDSGAWWALR LIAGAASALV FMIATSAMLA GLAAHMTGWA       180
     FGGVGAGIAL SGLMVVAVQQ AGSWQTAWFA CAVLTVLLTV AAWNLVPRGA AATAPAATAA       240
     AERPRTHRWF TALLTSYVLE GIGYIIAGTF LVAALQQGAP GWIGSGAWIV VGLAALPSCA       300
     VWMRLARLHR THETPGHNHN LRSLPNPGCL CVLSSPMGRE GLGFSLVGDH DAPHVVGQAA       360
     FQAPLRFLRR LTLREFALVV RVSG                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page