(data stored in ACNUC7421 zone)

EMBL: BA000030.PE309

BA000030.PE309       Location/Qualifiers
FT   CDS             362562..363170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_307"
FT                   /old_locus_tag="SAV_307"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_307"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68016"
FT                   /db_xref="UniProtKB/TrEMBL:Q82R37"
FT                   /protein_id="BAC68016.1"
FT                   /translation="MTIGRVWFAAGVTQDLEIVAFESAEAFQAWLGQNHAVSPGIWLKL
FT                   RKKGPGIAALDYTQALDVALCYGWIDGQKAKFDDQWWLQRFTPRKPRSKWSKANRDKVA
FT                   ALIEQGRMHPPGQAEVDRAKADGRWEAAYDGAKTATVPDDLTAALTADPAAAEFFETLD
FT                   RQNRYAILYRIQDAKKAETRARRIEKYVAMLAKGEKLHP"
     MTIGRVWFAA GVTQDLEIVA FESAEAFQAW LGQNHAVSPG IWLKLRKKGP GIAALDYTQA        60
     LDVALCYGWI DGQKAKFDDQ WWLQRFTPRK PRSKWSKANR DKVAALIEQG RMHPPGQAEV       120
     DRAKADGRWE AAYDGAKTAT VPDDLTAALT ADPAAAEFFE TLDRQNRYAI LYRIQDAKKA       180
     ETRARRIEKY VAMLAKGEKL HP                                                202
//

If you have problems or comments...

PBIL Back to PBIL home page