(data stored in ACNUC7421 zone)

EMBL: BA000030.PE31

BA000030.PE31        Location/Qualifiers
FT   CDS             38623..39624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_31"
FT                   /old_locus_tag="SAV_31"
FT                   /product="putative prepilin peptidase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_31"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67740"
FT                   /db_xref="GOA:Q82RW1"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RW1"
FT                   /protein_id="BAC67740.1"
FT                   /translation="MGRPSPAAHVVPQDVRDLTPLNGRNRAMTQHDPPTLPAHRPRASR
FT                   QAPEAPDAPSLSRTTRPWMPALLYTLGFLTVYLLAICTPWGQRAENALFGLGKQGGEEA
FT                   WFYPLSGAAYGSTPLPPLELSAKPTLMVGLAVIVVLTLVRRCWWPGCAALGVVILTTGG
FT                   KEVLKSTLPRPDLVGAPENLLDQGFPSGHTAIPAALTLAAVLVVSPRIRPYVATAGVLW
FT                   LACIAAYSATNGGHRPSEVLGATLLACACYGLATWLLPPSAAPGATRSPRALPVITLTL
FT                   ALAVALVSGARNDTLTRSLVSAATGFICAALVWYAAVGRPAHTARRTRPALG"
     MGRPSPAAHV VPQDVRDLTP LNGRNRAMTQ HDPPTLPAHR PRASRQAPEA PDAPSLSRTT        60
     RPWMPALLYT LGFLTVYLLA ICTPWGQRAE NALFGLGKQG GEEAWFYPLS GAAYGSTPLP       120
     PLELSAKPTL MVGLAVIVVL TLVRRCWWPG CAALGVVILT TGGKEVLKST LPRPDLVGAP       180
     ENLLDQGFPS GHTAIPAALT LAAVLVVSPR IRPYVATAGV LWLACIAAYS ATNGGHRPSE       240
     VLGATLLACA CYGLATWLLP PSAAPGATRS PRALPVITLT LALAVALVSG ARNDTLTRSL       300
     VSAATGFICA ALVWYAAVGR PAHTARRTRP ALG                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page