(data stored in ACNUC7421 zone)

EMBL: BA000030.PE310

BA000030.PE310       Location/Qualifiers
FT   CDS             complement(364046..364411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_308"
FT                   /old_locus_tag="SAV_308"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_308"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68017"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q82R36"
FT                   /protein_id="BAC68017.1"
FT                   /translation="MSITLNHTIVPAVDNEAAARFFASVMGLDYRGADRHFAPVQVNDS
FT                   LTLDFMSVENPVGHHLAFDVDPSSFDSILDRLRTAGVPYGNDPSEPDNGRIDHPLCPRG
FT                   LYFTDDAGNLYEVMSPR"
     MSITLNHTIV PAVDNEAAAR FFASVMGLDY RGADRHFAPV QVNDSLTLDF MSVENPVGHH        60
     LAFDVDPSSF DSILDRLRTA GVPYGNDPSE PDNGRIDHPL CPRGLYFTDD AGNLYEVMSP       120
     R                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page