(data stored in ACNUC7421 zone)

EMBL: BA000030.PE325

BA000030.PE325       Location/Qualifiers
FT   CDS             complement(380736..381536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_322"
FT                   /old_locus_tag="SAV_322"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_322"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68031"
FT                   /db_xref="GOA:Q82R23"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="UniProtKB/TrEMBL:Q82R23"
FT                   /protein_id="BAC68031.1"
FT                   /translation="MIAEDTQPPAHGREFQPRPDTTDALSTPVVDAPASATGQLAARQP
FT                   AAGLEGGVERATAALKPRLRGWLHAGVFPLALVGGIVLIAVSRSAAAVAACSVYALSAC
FT                   LLFGTSAVYHRGTWGARGEAVLRRMDHANIFLIIAGTYTPLAVLLLPGGEQLVLLAVVW
FT                   AGALAGIAFRVLWIGAPRWLYTPCYIVLGWVAVFYLPDFARTGGTAVVALVIAGGLLYT
FT                   AGAVVYGLKRPDPLPAWFGFHEVFHALTIAAFTAHYTAILLAAT"
     MIAEDTQPPA HGREFQPRPD TTDALSTPVV DAPASATGQL AARQPAAGLE GGVERATAAL        60
     KPRLRGWLHA GVFPLALVGG IVLIAVSRSA AAVAACSVYA LSACLLFGTS AVYHRGTWGA       120
     RGEAVLRRMD HANIFLIIAG TYTPLAVLLL PGGEQLVLLA VVWAGALAGI AFRVLWIGAP       180
     RWLYTPCYIV LGWVAVFYLP DFARTGGTAV VALVIAGGLL YTAGAVVYGL KRPDPLPAWF       240
     GFHEVFHALT IAAFTAHYTA ILLAAT                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page