(data stored in ACNUC7421 zone)

EMBL: BA000030.PE328

BA000030.PE328       Location/Qualifiers
FT   CDS             complement(383431..384198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_325"
FT                   /old_locus_tag="SAV_325"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_325"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68034"
FT                   /db_xref="UniProtKB/TrEMBL:Q82R20"
FT                   /protein_id="BAC68034.1"
FT                   /translation="MSMVGGQWPGAVERLAQQLGAAQAADRRVKEAKATAARQSPSSTG
FT                   LERAEYQRRLRAHVQTPEHKAAAHAISVAVALMKAHDAALLRSAHTLLARRANGQRLPR
FT                   RLPRPLVLPGGYAPQWWISSIDSTYAGIWRAIPSPGPELRLGSPNDPLVQEVAKQARLL
FT                   QASRVGYRGRDDLYEAFHPDGTREGGEPVPPIRGLSPETSRRTNLALGRGDGIRIQPSR
FT                   MEEAGQMHTDYFAVWDRSRAYAAAVLALLRAHA"
     MSMVGGQWPG AVERLAQQLG AAQAADRRVK EAKATAARQS PSSTGLERAE YQRRLRAHVQ        60
     TPEHKAAAHA ISVAVALMKA HDAALLRSAH TLLARRANGQ RLPRRLPRPL VLPGGYAPQW       120
     WISSIDSTYA GIWRAIPSPG PELRLGSPND PLVQEVAKQA RLLQASRVGY RGRDDLYEAF       180
     HPDGTREGGE PVPPIRGLSP ETSRRTNLAL GRGDGIRIQP SRMEEAGQMH TDYFAVWDRS       240
     RAYAAAVLAL LRAHA                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page