(data stored in ACNUC7421 zone)

EMBL: BA000030.PE33

BA000030.PE33        Location/Qualifiers
FT   CDS             complement(41665..41967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_33"
FT                   /old_locus_tag="SAV_33"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_33"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67742"
FT                   /db_xref="InterPro:IPR029476"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RV9"
FT                   /protein_id="BAC67742.1"
FT                   /translation="MTKERNEPSANPLRVGLKAALGGLRTVLPSGSQCDEYPFATTYEG
FT                   AAEYDYDPDARKFNFSVRPIAKADNGAGGSLLLSFYAKNRLIDGLEDGFGVKIVS"
     MTKERNEPSA NPLRVGLKAA LGGLRTVLPS GSQCDEYPFA TTYEGAAEYD YDPDARKFNF        60
     SVRPIAKADN GAGGSLLLSF YAKNRLIDGL EDGFGVKIVS                             100
//

If you have problems or comments...

PBIL Back to PBIL home page