(data stored in ACNUC7421 zone)

EMBL: BA000030.PE333

BA000030.PE333       Location/Qualifiers
FT   CDS             complement(387639..387947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_330"
FT                   /old_locus_tag="SAV_330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_330"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68039"
FT                   /db_xref="UniProtKB/TrEMBL:Q82R15"
FT                   /protein_id="BAC68039.1"
FT                   /translation="MNAWRMLAPEIHPTPKSTKHVGRAQVVIGGTARETQVRFDAEARA
FT                   WATTGPTTTAKNRAAVPAQPGPTQLQKPTAPAALPVRSDSSRRCRSDWDKAIGHLQG"
     MNAWRMLAPE IHPTPKSTKH VGRAQVVIGG TARETQVRFD AEARAWATTG PTTTAKNRAA        60
     VPAQPGPTQL QKPTAPAALP VRSDSSRRCR SDWDKAIGHL QG                          102
//

If you have problems or comments...

PBIL Back to PBIL home page