(data stored in ACNUC7421 zone)

EMBL: BA000030.PE335

BA000030.PE335       Location/Qualifiers
FT   CDS             complement(388386..388766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_333"
FT                   /old_locus_tag="SAV_333"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_333"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68041"
FT                   /db_xref="UniProtKB/TrEMBL:Q82R13"
FT                   /protein_id="BAC68041.1"
FT                   /translation="MGCPTARGARAADTHLRFSRDLVADLITQKLALEGVTFSWHPAER
FT                   KPYVLVKKTRKSPAEAAFKDPKVRDLVAKAAEPAPIIGSGGKPVSVDLDADSPHILVYA
FT                   STVGGKSVILRCIACQMIHRGS"
     MGCPTARGAR AADTHLRFSR DLVADLITQK LALEGVTFSW HPAERKPYVL VKKTRKSPAE        60
     AAFKDPKVRD LVAKAAEPAP IIGSGGKPVS VDLDADSPHI LVYASTVGGK SVILRCIACQ       120
     MIHRGS                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page