(data stored in ACNUC7421 zone)

EMBL: BA000030.PE339

BA000030.PE339       Location/Qualifiers
FT   CDS             complement(391476..392177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_336"
FT                   /old_locus_tag="SAV_336"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_336"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68045"
FT                   /db_xref="UniProtKB/TrEMBL:Q82R09"
FT                   /protein_id="BAC68045.1"
FT                   /translation="MTWLDLPPHSRCSNCNRKFVHDGRRAVCLSRLNALLPPTPTASSP
FT                   STRSAPNRATTCAKISSLTRPRIAVARSLSVQRAGSSNEPSTSRFNAIRQHRAVRCRSA
FT                   VRCLETSVSATKVRLPGLSRSDALELGEFVDRGAIAFHHEPVPEGSFGDLGVVTVVVAA
FT                   SAYTLKGMVSYLLYRHRGTSFEEVVEIEHPDGRIERRTLKWRDTSSESIDSALAKELAS
FT                   ATGIPWDQDGR"
     MTWLDLPPHS RCSNCNRKFV HDGRRAVCLS RLNALLPPTP TASSPSTRSA PNRATTCAKI        60
     SSLTRPRIAV ARSLSVQRAG SSNEPSTSRF NAIRQHRAVR CRSAVRCLET SVSATKVRLP       120
     GLSRSDALEL GEFVDRGAIA FHHEPVPEGS FGDLGVVTVV VAASAYTLKG MVSYLLYRHR       180
     GTSFEEVVEI EHPDGRIERR TLKWRDTSSE SIDSALAKEL ASATGIPWDQ DGR              233
//

If you have problems or comments...

PBIL Back to PBIL home page