(data stored in ACNUC7421 zone)

EMBL: BA000030.PE34

BA000030.PE34        Location/Qualifiers
FT   CDS             42010..44046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_34"
FT                   /old_locus_tag="SAV_34"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_34"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67743"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RV8"
FT                   /protein_id="BAC67743.1"
FT                   /translation="MGFVHLFPQRGRRLISLTARTTGRRRLALGTILAIVIGSGATGTA
FT                   YSADGSDNPPPVHGPGARAAAAAEPDTPNGPEVGPPFTKTNNVWQTDTTTPTLRNTVTA
FT                   PSGHKTTATFEVHTTDSSGKPTATVVKLTDENQWGVLVSGEVTAGKPASVTVPAGKLKN
FT                   GVTYAVRSSGYDATSNVYESDWSPYSTFKINVPPAEKPYVTFPAPQATSGIDSLAQTPI
FT                   EFTRTDPGPVTGLRGDDNGRKCSAPDAEGRKVCIEISRDAPTPEDAAVAKGAMRQALRG
FT                   ADLVSWCAAKPDGKDYMNRGEACLKKVGYATLIFVDADDLPRFGTATFALSQQIKLYNK
FT                   KSDTGTDRAEFDQQLTVVPTQIDDATEGVHLTWQPGDNCKDCTSSQVQWSSNDGLNTTP
FT                   HWAVGEVGAQYAMTAKRQTIWNGTGKEQFDLGWSLLGSVDAGNAHAQTSLGTSGDVRVR
FT                   ELAPRCDDIAGGNIKTGCVFPYFKPTWTVDTNLYPAAGAYYWLLQEKLPSHPGSRKWDS
FT                   LVTYLGPGNNADPDGGDWTNDDSRGIVCPTGTSGFKPNPATPDGSCDEYAPASTYQSGG
FT                   MPKGPNQVASGKECAQLYTKPMTGGTWGLLAENRDGYTGPKWNEKCGRASVPTDQNTGA
FT                   FRDLGIKFVPQMRLLDKDGFFISDPGFEHCKNADTVCAWKKVG"
     MGFVHLFPQR GRRLISLTAR TTGRRRLALG TILAIVIGSG ATGTAYSADG SDNPPPVHGP        60
     GARAAAAAEP DTPNGPEVGP PFTKTNNVWQ TDTTTPTLRN TVTAPSGHKT TATFEVHTTD       120
     SSGKPTATVV KLTDENQWGV LVSGEVTAGK PASVTVPAGK LKNGVTYAVR SSGYDATSNV       180
     YESDWSPYST FKINVPPAEK PYVTFPAPQA TSGIDSLAQT PIEFTRTDPG PVTGLRGDDN       240
     GRKCSAPDAE GRKVCIEISR DAPTPEDAAV AKGAMRQALR GADLVSWCAA KPDGKDYMNR       300
     GEACLKKVGY ATLIFVDADD LPRFGTATFA LSQQIKLYNK KSDTGTDRAE FDQQLTVVPT       360
     QIDDATEGVH LTWQPGDNCK DCTSSQVQWS SNDGLNTTPH WAVGEVGAQY AMTAKRQTIW       420
     NGTGKEQFDL GWSLLGSVDA GNAHAQTSLG TSGDVRVREL APRCDDIAGG NIKTGCVFPY       480
     FKPTWTVDTN LYPAAGAYYW LLQEKLPSHP GSRKWDSLVT YLGPGNNADP DGGDWTNDDS       540
     RGIVCPTGTS GFKPNPATPD GSCDEYAPAS TYQSGGMPKG PNQVASGKEC AQLYTKPMTG       600
     GTWGLLAENR DGYTGPKWNE KCGRASVPTD QNTGAFRDLG IKFVPQMRLL DKDGFFISDP       660
     GFEHCKNADT VCAWKKVG                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page