(data stored in ACNUC7421 zone)

EMBL: BA000030.PE341

BA000030.PE341       Location/Qualifiers
FT   CDS             complement(393683..394816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_338"
FT                   /old_locus_tag="SAV_338"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_338"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68047"
FT                   /db_xref="UniProtKB/TrEMBL:Q82R07"
FT                   /protein_id="BAC68047.1"
FT                   /translation="MSTPTATRLQAADADVTVLSNTAFVTDWSRRYFGPWWNAFEVPTS
FT                   SVCAGPLVTADVDEKAYADLAALLASVPHSEATYAKARLLLARDSTGTITAVSPDEQLA
FT                   YRSEQLGGHVTISGHAPQPVALAASRIAREMIRAALLRDGWTLLHASAVVRDGRALLAF
FT                   GDKGAGKTTTALLVASRCAQLLANDRVFIKRIGADLRVLPWPSAAAIGLGLLDALGLYD
FT                   VVRDRLQAGEHLHPTQHQDVTDALLAGRREPLWEPGGKRERKVQVFPDQFASWFGMELA
FT                   TGGRAAALLFPRIDPAAVPALVDGERTLGEDDFMSGATEDRYPDHFGLAHGIDGGGSDL
FT                   ARATVAEHLAALPHHQVVLGHDVGANADFLAKLSDSP"
     MSTPTATRLQ AADADVTVLS NTAFVTDWSR RYFGPWWNAF EVPTSSVCAG PLVTADVDEK        60
     AYADLAALLA SVPHSEATYA KARLLLARDS TGTITAVSPD EQLAYRSEQL GGHVTISGHA       120
     PQPVALAASR IAREMIRAAL LRDGWTLLHA SAVVRDGRAL LAFGDKGAGK TTTALLVASR       180
     CAQLLANDRV FIKRIGADLR VLPWPSAAAI GLGLLDALGL YDVVRDRLQA GEHLHPTQHQ       240
     DVTDALLAGR REPLWEPGGK RERKVQVFPD QFASWFGMEL ATGGRAAALL FPRIDPAAVP       300
     ALVDGERTLG EDDFMSGATE DRYPDHFGLA HGIDGGGSDL ARATVAEHLA ALPHHQVVLG       360
     HDVGANADFL AKLSDSP                                                      377
//

If you have problems or comments...

PBIL Back to PBIL home page