(data stored in ACNUC7421 zone)

EMBL: BA000030.PE343

BA000030.PE343       Location/Qualifiers
FT   CDS             complement(395736..397091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_340"
FT                   /old_locus_tag="SAV_340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_340"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68049"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q82R05"
FT                   /protein_id="BAC68049.1"
FT                   /translation="MHGSSRQVGRSSTGQPGAPPQPPCAHPPGAPGGIHPLPLEAYVST
FT                   TAVSTSPGPVPPVPDADEVFAFAAREIAAAAAGLWPRADVDLGDHVPSVTGYVRRIRVD
FT                   GRTLYAKYAFLGVSLVSLLRGACGPWPDVRAAQQAYVQRPGALMDREAAQLRLLAQLDS
FT                   PRVCPVAGLARGVLFTESVTGPTLADLLLQRPHDAADLLEGLFGELRRLHRPSAARLLG
FT                   PARGIGEHSIRGTFQRKFNGLSGPTYVERLGAERCAPGDRALVVGLLRDVVVRLHRLQA
FT                   TGLPQQASRRVLAYGDLKPEHVVFPEGTSGQPVFIDPGLLLAPPTVDAAKLISRTVLLL
FT                   AAARPGAGTGQQAMRGVGAFAAARADVLPARVRRSWLRELLVLWLMDSVNILTTYLSAP
FT                   GVLPMPGRGSALIGRAVDLCRMADQLSSELAAGADTRAVWESALGLAQAVAA"
     MHGSSRQVGR SSTGQPGAPP QPPCAHPPGA PGGIHPLPLE AYVSTTAVST SPGPVPPVPD        60
     ADEVFAFAAR EIAAAAAGLW PRADVDLGDH VPSVTGYVRR IRVDGRTLYA KYAFLGVSLV       120
     SLLRGACGPW PDVRAAQQAY VQRPGALMDR EAAQLRLLAQ LDSPRVCPVA GLARGVLFTE       180
     SVTGPTLADL LLQRPHDAAD LLEGLFGELR RLHRPSAARL LGPARGIGEH SIRGTFQRKF       240
     NGLSGPTYVE RLGAERCAPG DRALVVGLLR DVVVRLHRLQ ATGLPQQASR RVLAYGDLKP       300
     EHVVFPEGTS GQPVFIDPGL LLAPPTVDAA KLISRTVLLL AAARPGAGTG QQAMRGVGAF       360
     AAARADVLPA RVRRSWLREL LVLWLMDSVN ILTTYLSAPG VLPMPGRGSA LIGRAVDLCR       420
     MADQLSSELA AGADTRAVWE SALGLAQAVA A                                      451
//

If you have problems or comments...

PBIL Back to PBIL home page