(data stored in ACNUC7421 zone)

EMBL: BA000030.PE345

BA000030.PE345       Location/Qualifiers
FT   CDS             complement(397612..398019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_342"
FT                   /old_locus_tag="SAV_342"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_342"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68051"
FT                   /db_xref="UniProtKB/TrEMBL:Q82R03"
FT                   /protein_id="BAC68051.1"
FT                   /translation="MTRTPDTRENITVAASASAAVLYVCAERSKLTPTLAADRAEAEGR
FT                   DFAEARGLTITEVVTDPYGDPDPCHRDGWLRVRELAESGAVRVVIVRWPACIAPEPSHE
FT                   LRHREIRWLQDHCVQVRYSWEPLATGGGEAK"
     MTRTPDTREN ITVAASASAA VLYVCAERSK LTPTLAADRA EAEGRDFAEA RGLTITEVVT        60
     DPYGDPDPCH RDGWLRVREL AESGAVRVVI VRWPACIAPE PSHELRHREI RWLQDHCVQV       120
     RYSWEPLATG GGEAK                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page