(data stored in ACNUC7421 zone)

EMBL: BA000030.PE346

BA000030.PE346       Location/Qualifiers
FT   CDS             398215..399555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_343"
FT                   /old_locus_tag="SAV_343"
FT                   /product="putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_343"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68052"
FT                   /db_xref="UniProtKB/TrEMBL:Q82R02"
FT                   /protein_id="BAC68052.1"
FT                   /translation="MARRPRTPNAALAALMQSGGIGNAQLARRVNAAGRELGLRMHYDK
FT                   TSVSHWLAGSVPKLEARPAVTEALSRLLGRPVTCAEVGWETEEKPAGERDFVAGVIDLS
FT                   RADMDPTRRGVLKTGMYAAALAVPRYEDVAGRLESATAGRTVHIGRSDVETVRTMTDKV
FT                   ADILDQVGAGHARPMAAAFLVNTAGPYLRASGTDEVQRDMRAAVADFVYLTGWMAMYED
FT                   QQGLGQTYYLRALELAGAAEDHVTYCRTLRGMSLQATHLGHGKKGLELADAAAEAAPSA
FT                   GPRLVAFLCGQQAAAAAMTNARNTALARLREAESALSRADDRRDAVGGYDQAAYFFHEA
FT                   HVRWHLGDKDGSIASLRRSNTARSPLERQGRLHCLGVTAERQFRMRHIEAACQTWGTFL
FT                   DEHVTISSARGDEHLKTMLKALPAYRRVAGVRELEERARHVATLKTA"
     MARRPRTPNA ALAALMQSGG IGNAQLARRV NAAGRELGLR MHYDKTSVSH WLAGSVPKLE        60
     ARPAVTEALS RLLGRPVTCA EVGWETEEKP AGERDFVAGV IDLSRADMDP TRRGVLKTGM       120
     YAAALAVPRY EDVAGRLESA TAGRTVHIGR SDVETVRTMT DKVADILDQV GAGHARPMAA       180
     AFLVNTAGPY LRASGTDEVQ RDMRAAVADF VYLTGWMAMY EDQQGLGQTY YLRALELAGA       240
     AEDHVTYCRT LRGMSLQATH LGHGKKGLEL ADAAAEAAPS AGPRLVAFLC GQQAAAAAMT       300
     NARNTALARL REAESALSRA DDRRDAVGGY DQAAYFFHEA HVRWHLGDKD GSIASLRRSN       360
     TARSPLERQG RLHCLGVTAE RQFRMRHIEA ACQTWGTFLD EHVTISSARG DEHLKTMLKA       420
     LPAYRRVAGV RELEERARHV ATLKTA                                            446
//

If you have problems or comments...

PBIL Back to PBIL home page