(data stored in ACNUC7421 zone)

EMBL: BA000030.PE347

BA000030.PE347       Location/Qualifiers
FT   CDS             complement(399603..400892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_344"
FT                   /old_locus_tag="SAV_344"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_344"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68053"
FT                   /db_xref="InterPro:IPR010330"
FT                   /db_xref="UniProtKB/TrEMBL:Q82R01"
FT                   /protein_id="BAC68053.1"
FT                   /translation="MGYTAVHPVWGRLDASMDDLGCDRAWTDVHRVKGLRLACPECGGR
FT                   VFARASQHVVRHFYHQVRPPDCELANESPEHHLLKLELVVAARAAGWRAELEVSSEVRN
FT                   WRADVMVFDEHDRPFMALEAQLSPMTQDEARMRTDRYARDGVAVCWVALQDRPWERVVP
FT                   SLRVRSPRRRGETWTVWHGMARYDWAPRTLKAKAKWVHITCPLGDAIRWILDGRVHAHT
FT                   GANGTVWWTAPAYEDLVLARAQMEAEAEAVRRVAAAERRRQEAEQRAAAAEQHRQDAER
FT                   RALEWQAELLEWQAELQRLAGFFQRTGLDATVWEAFTQMVRSASGKAIMYGDQSPAHGN
FT                   GLLVYARPRWTGDGFTLAGVVCPDLEALIEWPAELTILVPNQTWLSRIQAAARSPLKVA
FT                   VLNPVTGRSTFIRVTAPDVVPVRPNGPDRG"
     MGYTAVHPVW GRLDASMDDL GCDRAWTDVH RVKGLRLACP ECGGRVFARA SQHVVRHFYH        60
     QVRPPDCELA NESPEHHLLK LELVVAARAA GWRAELEVSS EVRNWRADVM VFDEHDRPFM       120
     ALEAQLSPMT QDEARMRTDR YARDGVAVCW VALQDRPWER VVPSLRVRSP RRRGETWTVW       180
     HGMARYDWAP RTLKAKAKWV HITCPLGDAI RWILDGRVHA HTGANGTVWW TAPAYEDLVL       240
     ARAQMEAEAE AVRRVAAAER RRQEAEQRAA AAEQHRQDAE RRALEWQAEL LEWQAELQRL       300
     AGFFQRTGLD ATVWEAFTQM VRSASGKAIM YGDQSPAHGN GLLVYARPRW TGDGFTLAGV       360
     VCPDLEALIE WPAELTILVP NQTWLSRIQA AARSPLKVAV LNPVTGRSTF IRVTAPDVVP       420
     VRPNGPDRG                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page