(data stored in ACNUC7421 zone)

EMBL: BA000030.PE348

BA000030.PE348       Location/Qualifiers
FT   CDS             401070..401894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_345"
FT                   /old_locus_tag="SAV_345"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_345"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68054"
FT                   /db_xref="UniProtKB/TrEMBL:Q82R00"
FT                   /protein_id="BAC68054.1"
FT                   /translation="MYAAARQPEGEGQAAESRATGVYRERAERRRRTRGTGEARGDGWQ
FT                   RTEEDEQLLRLATRYSTLTLHQAAYACWGGRIEAARRRVRLMVEAGLLHRLAVADVGIR
FT                   LESEGRTVLSEREVHAAEAVPGRAAELLADLGVHQVPVGVRRGEILAVPVGARAVHWPD
FT                   LVVVLPGGRLAAFEVELTAKPAAALRTILRAYKQARRPVAYLATEPVVGQLQGGPGPGG
FT                   RWVNGVAQELELLPPGGPGPGADGHLQVRPFTAVDPAVARRTAQQAARLRGG"
     MYAAARQPEG EGQAAESRAT GVYRERAERR RRTRGTGEAR GDGWQRTEED EQLLRLATRY        60
     STLTLHQAAY ACWGGRIEAA RRRVRLMVEA GLLHRLAVAD VGIRLESEGR TVLSEREVHA       120
     AEAVPGRAAE LLADLGVHQV PVGVRRGEIL AVPVGARAVH WPDLVVVLPG GRLAAFEVEL       180
     TAKPAAALRT ILRAYKQARR PVAYLATEPV VGQLQGGPGP GGRWVNGVAQ ELELLPPGGP       240
     GPGADGHLQV RPFTAVDPAV ARRTAQQAAR LRGG                                   274
//

If you have problems or comments...

PBIL Back to PBIL home page