(data stored in ACNUC7421 zone)

EMBL: BA000030.PE349

BA000030.PE349       Location/Qualifiers
FT   CDS             402923..404059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_346"
FT                   /old_locus_tag="SAV_346"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_346"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68055"
FT                   /db_xref="GOA:Q82QZ9"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QZ9"
FT                   /protein_id="BAC68055.1"
FT                   /translation="MQHLSTPLARTLGAAALLSAAAAWGAASIRYEADGPRLDVLVPLA
FT                   LAAVFVVGWLMASRSAPPVKLLPSTAPPREKVPGKLGAVRRDWGLVAAAYLTVWAPFAA
FT                   ANSAYGGRGSQLGALYCLLTFIVGAVLSLCNLALLQSNLGRSQRMLKEDAAAGSVHAIR
FT                   VRFGTPVLEMYRYPTGQGAGRIAASTTYGVELVHESDSGEQRTIRLRAMKAAQSDKVGD
FT                   KHLTYAASQLVGHGGWLCWPARWRDIAGTNKDLKVPAAFASDSGHVVWGEMQQDDYAYY
FT                   LRDGAAPLCETDPRLAVAPLPRPSRYFPKVHASHLRVAAVGALLAVPFLLDAVPYWAGL
FT                   LLGVVSGALGLLAGMTMDGVGVDQEPWTVRTTSHPSLQ"
     MQHLSTPLAR TLGAAALLSA AAAWGAASIR YEADGPRLDV LVPLALAAVF VVGWLMASRS        60
     APPVKLLPST APPREKVPGK LGAVRRDWGL VAAAYLTVWA PFAAANSAYG GRGSQLGALY       120
     CLLTFIVGAV LSLCNLALLQ SNLGRSQRML KEDAAAGSVH AIRVRFGTPV LEMYRYPTGQ       180
     GAGRIAASTT YGVELVHESD SGEQRTIRLR AMKAAQSDKV GDKHLTYAAS QLVGHGGWLC       240
     WPARWRDIAG TNKDLKVPAA FASDSGHVVW GEMQQDDYAY YLRDGAAPLC ETDPRLAVAP       300
     LPRPSRYFPK VHASHLRVAA VGALLAVPFL LDAVPYWAGL LLGVVSGALG LLAGMTMDGV       360
     GVDQEPWTVR TTSHPSLQ                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page