(data stored in ACNUC7421 zone)

EMBL: BA000030.PE352

BA000030.PE352       Location/Qualifiers
FT   CDS             408998..409465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_349"
FT                   /old_locus_tag="SAV_349"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_349"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68058"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QZ6"
FT                   /protein_id="BAC68058.1"
FT                   /translation="MQTFLPFPDFAASAAALDPRRLGKQRVEALQLLRGLMVPGYGWRH
FT                   HPAVRMWTGYEEALVRYGLEVCCVWTAAGRADTCAGSLMTDFTAHRADVGVRTQERLAA
FT                   DGELPPWLGNPAFHRSHRSALRRKDPGFYAPLFPDVPEDLPYVWPASDRSR"
     MQTFLPFPDF AASAAALDPR RLGKQRVEAL QLLRGLMVPG YGWRHHPAVR MWTGYEEALV        60
     RYGLEVCCVW TAAGRADTCA GSLMTDFTAH RADVGVRTQE RLAADGELPP WLGNPAFHRS       120
     HRSALRRKDP GFYAPLFPDV PEDLPYVWPA SDRSR                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page