(data stored in ACNUC7421 zone)

EMBL: BA000030.PE356

BA000030.PE356       Location/Qualifiers
FT   CDS             414815..416212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_353"
FT                   /old_locus_tag="SAV_353"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_353"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68062"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038721"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QZ2"
FT                   /protein_id="BAC68062.1"
FT                   /translation="MSLLHHDARHEAFDFTSHFREDLYTCLTRRGDTLFELCDAMLCED
FT                   GPVTSPVDLTLLAEHRRGHGALYDALNQGRIDAVRLRKALAMLPQPKAADGRLVLAVDV
FT                   SAWLRPDAPCSPDRLFCHVSGRSGRSSDQFIPGWPYSFVAALETARTSWCQLLDAVRLG
FT                   PDDDVAEVTAAQVRRVVTDLIGQGQWEDGDDDILVVFDAGYDAPRMAYLLDSLPVEVLG
FT                   RMRADRVMRRPAPSPKEYAVSYPQGGRPPKHGKEFRFARPDTWGDPDAETVQVTDRYGA
FT                   AKAMAWDRIQPRLTTRSAWIDHDSELPIIEGTLIRLQVDHLPGGGDPLPVWLWSSKTGM
FT                   TSTDVDLRWQAFLRRFDLEHTFRFVKQTLGWTRPRLRTPEAADRWTWLVIAAHTQLRLT
FT                   PARVRRGFRNLRPHLHSPARAPKPSTPGLTTTAPALFSSCRVAAAASSGPRTTVPAAGP
FT                   RPRSRAS"
     MSLLHHDARH EAFDFTSHFR EDLYTCLTRR GDTLFELCDA MLCEDGPVTS PVDLTLLAEH        60
     RRGHGALYDA LNQGRIDAVR LRKALAMLPQ PKAADGRLVL AVDVSAWLRP DAPCSPDRLF       120
     CHVSGRSGRS SDQFIPGWPY SFVAALETAR TSWCQLLDAV RLGPDDDVAE VTAAQVRRVV       180
     TDLIGQGQWE DGDDDILVVF DAGYDAPRMA YLLDSLPVEV LGRMRADRVM RRPAPSPKEY       240
     AVSYPQGGRP PKHGKEFRFA RPDTWGDPDA ETVQVTDRYG AAKAMAWDRI QPRLTTRSAW       300
     IDHDSELPII EGTLIRLQVD HLPGGGDPLP VWLWSSKTGM TSTDVDLRWQ AFLRRFDLEH       360
     TFRFVKQTLG WTRPRLRTPE AADRWTWLVI AAHTQLRLTP ARVRRGFRNL RPHLHSPARA       420
     PKPSTPGLTT TAPALFSSCR VAAAASSGPR TTVPAAGPRP RSRAS                       465
//

If you have problems or comments...

PBIL Back to PBIL home page