(data stored in ACNUC7421 zone)

EMBL: BA000030.PE359

BA000030.PE359       Location/Qualifiers
FT   CDS             420855..422207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_356"
FT                   /old_locus_tag="SAV_356"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_356"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68065"
FT                   /db_xref="GOA:Q82QY9"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QY9"
FT                   /protein_id="BAC68065.1"
FT                   /translation="MVNRPGDDRTVLLRLPTPPQRPTWADDPLDELAERLADVCGAAVH
FT                   PDEIAAVLESDGLTHQQITTRYSRRDLFAIAEELYTRVPRRFPDPGPGPDPWRTSPWQC
FT                   LLRGMLFGLPGLAYLLGAGLLPGRVTGLAASALVAWAWNQALAHRAYVRLAAGGRRAAA
FT                   RCLLLGAPAGVTAAAAAALAVSGAGAAPAFAAGEALYLAAATVLLVLGREQHLLIALVP
FT                   TAAGAACIPLWHPGPVPVAVLLLATVAAAALSAVREIVRSLRTTSSAAPGTPRLTASVP
FT                   YGLFGLAGGALTLMAPAAGRPAAVVLTLSMGVAEWLLYRYRSLTLTALRHSRTPWGFRL
FT                   RAVGVLALCLTGYLAVLAAPALVTGVPPLPLLALGAALWVALLLQAAGIAWPSAVACLA
FT                   AAVAEVALSGGANRGPGLLSPATAELAACGCATAVLLAVACTRMGRTTAHR"
     MVNRPGDDRT VLLRLPTPPQ RPTWADDPLD ELAERLADVC GAAVHPDEIA AVLESDGLTH        60
     QQITTRYSRR DLFAIAEELY TRVPRRFPDP GPGPDPWRTS PWQCLLRGML FGLPGLAYLL       120
     GAGLLPGRVT GLAASALVAW AWNQALAHRA YVRLAAGGRR AAARCLLLGA PAGVTAAAAA       180
     ALAVSGAGAA PAFAAGEALY LAAATVLLVL GREQHLLIAL VPTAAGAACI PLWHPGPVPV       240
     AVLLLATVAA AALSAVREIV RSLRTTSSAA PGTPRLTASV PYGLFGLAGG ALTLMAPAAG       300
     RPAAVVLTLS MGVAEWLLYR YRSLTLTALR HSRTPWGFRL RAVGVLALCL TGYLAVLAAP       360
     ALVTGVPPLP LLALGAALWV ALLLQAAGIA WPSAVACLAA AVAEVALSGG ANRGPGLLSP       420
     ATAELAACGC ATAVLLAVAC TRMGRTTAHR                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page