(data stored in ACNUC7421 zone)

EMBL: BA000030.PE366

BA000030.PE366       Location/Qualifiers
FT   CDS             complement(427297..428631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_363"
FT                   /old_locus_tag="SAV_363"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_363"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68072"
FT                   /db_xref="GOA:Q82QY2"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QY2"
FT                   /protein_id="BAC68072.1"
FT                   /translation="MAEALNGSFKAELIEHQGPWRDADQVERSVVQWVGWYNTERLHSA
FT                   LDCLPPRGIRDPALPISGSNERRLKPRKPAATKLGAAHNGLYVTALGLLLAQYTFCGYD
FT                   ASSHLSEETTQAQISAPRGIVRSIWVSWIAGFILLAGLTSAIQDYAGTQSSSTGVPPAQ
FT                   IFLDVLGADGAKALMLIVIVAQLFSGSAETAAASRMVFAFSRDGAIPFAATWRRVSPRT
FT                   KTPAAAVWLSVGSALVLAAPSLYSPTAYAAVTAINVIGITPGPPWRTRPRGSCGTAPSM
FT                   PSTPSATSTGTGPHSWPSTTPSSTAPPFGRSHLCGHQPEAGANPRIRSNPYTTSLDAAH
FT                   GYFAEGTRLTAVATLGGAAYRRYAQQTRRSSPPRAAGGGVMWIFLVLGLLPIVLLLWTF
FT                   AGQVNQQMDSQFAGEVIALSVHRVTLTTGMRTDYVLTTVGSSPCR"
     MAEALNGSFK AELIEHQGPW RDADQVERSV VQWVGWYNTE RLHSALDCLP PRGIRDPALP        60
     ISGSNERRLK PRKPAATKLG AAHNGLYVTA LGLLLAQYTF CGYDASSHLS EETTQAQISA       120
     PRGIVRSIWV SWIAGFILLA GLTSAIQDYA GTQSSSTGVP PAQIFLDVLG ADGAKALMLI       180
     VIVAQLFSGS AETAAASRMV FAFSRDGAIP FAATWRRVSP RTKTPAAAVW LSVGSALVLA       240
     APSLYSPTAY AAVTAINVIG ITPGPPWRTR PRGSCGTAPS MPSTPSATST GTGPHSWPST       300
     TPSSTAPPFG RSHLCGHQPE AGANPRIRSN PYTTSLDAAH GYFAEGTRLT AVATLGGAAY       360
     RRYAQQTRRS SPPRAAGGGV MWIFLVLGLL PIVLLLWTFA GQVNQQMDSQ FAGEVIALSV       420
     HRVTLTTGMR TDYVLTTVGS SPCR                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page