(data stored in ACNUC7421 zone)

EMBL: BA000030.PE369

BA000030.PE369       Location/Qualifiers
FT   CDS             432038..434323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_366"
FT                   /old_locus_tag="SAV_366"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_366"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68075"
FT                   /db_xref="InterPro:IPR012912"
FT                   /db_xref="InterPro:IPR024047"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QX9"
FT                   /protein_id="BAC68075.1"
FT                   /translation="MMGPFEQPRCGGSKQMRLDGKTAPSDLQLKIVLHGTRPPLWRRLL
FT                   LPSDTSLGTLHDAIQVAFGWHGGHLHLFTDEFGRGYGDAARLTDIDLGFGRGVGDEDTT
FT                   ALGDVLAEEGARLRYVYDFGDDWEHGITLEKTLPRPVGAERTVRCVGGRRADAPAEDIG
FT                   GVSGLAEVLGFLDTPDGAFDGPYGELVAELRAAGYDPAAFDRDAITARLAEVTPDTVSG
FT                   KAKPPAGDRSGRGGVRRLTAEDVALCTCGQCGVGDPVDAGVDGPAEDVPVLRPVTLAPQ
FT                   EDLVAAVRGVPLFDAALRLAAWCHEGRQVTAGRVLRPALAREAVEELQLWKLAGHDSPY
FT                   ADAVARSRALKSLRSAKDVAVLDDPWWLAVDGEMITIRGGRASGGAATDFTGEDLLEFW
FT                   AATMGDLLEEIGETGVLDGWHGELGELTAEIADGLVGLLYDAPDDAWVDGDDLRAKARE
FT                   RGENGPEFDLFRALFAASFRALGEGLALLGAVEYESGDGDDSAEETLRTLLNAVVGQKP
FT                   GGSGTLPSASDWSRDDRRGDRMRLTPLGRYGLRAYLMECGVPAPLLGEYAEADAGALLQ
FT                   GLLGYSPEELRREVEGWLEHRTAADAAVGLLDACAGADHEAAAKRAVAQLVLADLDDPR
FT                   ALRVLRKAADSDVEGCRQVATATLGAHLEGEAPVDPARAEEAGLWLLIDGLSILAGAGE
FT                   TEELVRGFLENGNTAPEALEQRVDELWRVEHPATAQVLAELGEGLRGVDKRLAKRMRTA
FT                   ANKAQSRR"
     MMGPFEQPRC GGSKQMRLDG KTAPSDLQLK IVLHGTRPPL WRRLLLPSDT SLGTLHDAIQ        60
     VAFGWHGGHL HLFTDEFGRG YGDAARLTDI DLGFGRGVGD EDTTALGDVL AEEGARLRYV       120
     YDFGDDWEHG ITLEKTLPRP VGAERTVRCV GGRRADAPAE DIGGVSGLAE VLGFLDTPDG       180
     AFDGPYGELV AELRAAGYDP AAFDRDAITA RLAEVTPDTV SGKAKPPAGD RSGRGGVRRL       240
     TAEDVALCTC GQCGVGDPVD AGVDGPAEDV PVLRPVTLAP QEDLVAAVRG VPLFDAALRL       300
     AAWCHEGRQV TAGRVLRPAL AREAVEELQL WKLAGHDSPY ADAVARSRAL KSLRSAKDVA       360
     VLDDPWWLAV DGEMITIRGG RASGGAATDF TGEDLLEFWA ATMGDLLEEI GETGVLDGWH       420
     GELGELTAEI ADGLVGLLYD APDDAWVDGD DLRAKARERG ENGPEFDLFR ALFAASFRAL       480
     GEGLALLGAV EYESGDGDDS AEETLRTLLN AVVGQKPGGS GTLPSASDWS RDDRRGDRMR       540
     LTPLGRYGLR AYLMECGVPA PLLGEYAEAD AGALLQGLLG YSPEELRREV EGWLEHRTAA       600
     DAAVGLLDAC AGADHEAAAK RAVAQLVLAD LDDPRALRVL RKAADSDVEG CRQVATATLG       660
     AHLEGEAPVD PARAEEAGLW LLIDGLSILA GAGETEELVR GFLENGNTAP EALEQRVDEL       720
     WRVEHPATAQ VLAELGEGLR GVDKRLAKRM RTAANKAQSR R                           761
//

If you have problems or comments...

PBIL Back to PBIL home page