(data stored in ACNUC7421 zone)

EMBL: BA000030.PE37

BA000030.PE37        Location/Qualifiers
FT   CDS             complement(45819..47141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_37"
FT                   /old_locus_tag="SAV_37"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_37"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67746"
FT                   /db_xref="GOA:Q82RV5"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019405"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RV5"
FT                   /protein_id="BAC67746.1"
FT                   /translation="MCRGPLGSYESLTRPSFAFIVISPSATLLTHAPGSQEPHVSRHNR
FT                   RRSTLHKRATVFGGGTVAVAAVVATVNIASADQVSPTPRTASKADHAVFVQGNELAGNT
FT                   IHVFRRGDDGKLTAAGKYATGGKGGDQVDAPTDSLASQGSLVYDRRSGRLLALNAGSGT
FT                   LTSYAVHGQKLTDRQTVPTGGDFPVGIAVSGDLAYVMNAGGAGSVQGFRITTMGLKPLS
FT                   GSLRTLGLKNEKVPLFSSSPGQAAFTPDGRNLVVTTKSANTVEVFPIGRDGRPAHKPVV
FT                   NKSAGMVPFAIAFDKTGRMLVAEAAESTVSTYKVRRNGELQVLQKPLPNGQDTLCWLER
FT                   AGDFFYGGNTGNSTVSGYRMDARGRLALTNEAGIAAAPSAKSQGVIDIAVAADKFVYVQ
FT                   NATSGTVDGFRVGRTGALTKVTTVTDLPAFAESGMEGIAAV"
     MCRGPLGSYE SLTRPSFAFI VISPSATLLT HAPGSQEPHV SRHNRRRSTL HKRATVFGGG        60
     TVAVAAVVAT VNIASADQVS PTPRTASKAD HAVFVQGNEL AGNTIHVFRR GDDGKLTAAG       120
     KYATGGKGGD QVDAPTDSLA SQGSLVYDRR SGRLLALNAG SGTLTSYAVH GQKLTDRQTV       180
     PTGGDFPVGI AVSGDLAYVM NAGGAGSVQG FRITTMGLKP LSGSLRTLGL KNEKVPLFSS       240
     SPGQAAFTPD GRNLVVTTKS ANTVEVFPIG RDGRPAHKPV VNKSAGMVPF AIAFDKTGRM       300
     LVAEAAESTV STYKVRRNGE LQVLQKPLPN GQDTLCWLER AGDFFYGGNT GNSTVSGYRM       360
     DARGRLALTN EAGIAAAPSA KSQGVIDIAV AADKFVYVQN ATSGTVDGFR VGRTGALTKV       420
     TTVTDLPAFA ESGMEGIAAV                                                   440
//

If you have problems or comments...

PBIL Back to PBIL home page