(data stored in ACNUC7421 zone)

EMBL: BA000030.PE371

BA000030.PE371       Location/Qualifiers
FT   CDS             437259..438503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_368"
FT                   /old_locus_tag="SAV_368"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_368"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68077"
FT                   /db_xref="GOA:Q82QX7"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QX7"
FT                   /protein_id="BAC68077.1"
FT                   /translation="MSPSIPGPRRAPARGRRAFAATWWGQAWVTALEDSTLDSGRLSRG
FT                   RTYARQGMVGPTTVAPGQVKAPVQGSRPRPYRCSVHLSVLTDTQWDTLLDTIAARAGHL
FT                   AALLGGEMPGELVDDARRAGVPLLPQSTELDPDCSCPDWGYPCKHAAALCYAIAATIDA
FT                   DPFVLFALRGRDREEVITQLRARRTAAQATSTPPAPAGLPAAGAYTAWGALADQPPSLP
FT                   ELPEPAPHTAALPAAPPPGTGLSAADLERLMADTAARAARLLTGDTTSLHLSQHEDAAR
FT                   IASSNCGPEWFHRLIQNTGAKPAAFARLTRAWRYGGPTGITVAEQPRTPDPTAMTAART
FT                   ALTETLTEMTTPPVALRAWRNRLTLADHGIQLRLGPDTRWYPYLQDDDGDWWPAAPADP
FT                   DPVTALTSVWQQTER"
     MSPSIPGPRR APARGRRAFA ATWWGQAWVT ALEDSTLDSG RLSRGRTYAR QGMVGPTTVA        60
     PGQVKAPVQG SRPRPYRCSV HLSVLTDTQW DTLLDTIAAR AGHLAALLGG EMPGELVDDA       120
     RRAGVPLLPQ STELDPDCSC PDWGYPCKHA AALCYAIAAT IDADPFVLFA LRGRDREEVI       180
     TQLRARRTAA QATSTPPAPA GLPAAGAYTA WGALADQPPS LPELPEPAPH TAALPAAPPP       240
     GTGLSAADLE RLMADTAARA ARLLTGDTTS LHLSQHEDAA RIASSNCGPE WFHRLIQNTG       300
     AKPAAFARLT RAWRYGGPTG ITVAEQPRTP DPTAMTAART ALTETLTEMT TPPVALRAWR       360
     NRLTLADHGI QLRLGPDTRW YPYLQDDDGD WWPAAPADPD PVTALTSVWQ QTER             414
//

If you have problems or comments...

PBIL Back to PBIL home page