(data stored in ACNUC7421 zone)

EMBL: BA000030.PE384

BA000030.PE384       Location/Qualifiers
FT   CDS             453216..454730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_381"
FT                   /old_locus_tag="SAV_381"
FT                   /product="putative phage tail sheath protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_381"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68090"
FT                   /db_xref="InterPro:IPR020287"
FT                   /db_xref="InterPro:IPR035089"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QW4"
FT                   /protein_id="BAC68090.1"
FT                   /translation="MTTQFSYPGVYIEEIESPVRPIAGAETSVTAFVGPALFGPTSPTT
FT                   VESWADFEKEFGGLWQGSELSYAVYQFFLNGGSKAIVVRVGEGVEYAGVDLKNGVKLKA
FT                   KAPGAAGKKLKATVTLDANDNKRYTLLISDGTTSESYDVTIDPALRNRWLDRQLATSQL
FT                   VERDTETFDKRPDAVTDESFTGGKDATFTPAHVLGDATKLPHTGLAALADVEIFNLLVI
FT                   PAQLAKPSGTDDRDTKWAPVVDAAVRLCEEQRAMLLLDPPFGWDSPETAVTGARAGMPV
FT                   GGLAGRNAAVFFPKVVISDPLSGGNLEVGPAGTVAGVIARTDTRRGVWKAPAGTDDGGL
FT                   LGVRSLAFRLSDQQNGTLNKLGVNCLRTVPVYGNVLWGSRTCRGGDAVSDPWKYIPVRR
FT                   VALHIEESLFIGTKWVVFEPNDEPLWSSIRLNIGAFMNRLFRQGAFQGPTAKGAYFVRC
FT                   DASNNPQDDINDGIVTIDVGFQPLSPAEFVHIRIQQKRDDATAQGS"
     MTTQFSYPGV YIEEIESPVR PIAGAETSVT AFVGPALFGP TSPTTVESWA DFEKEFGGLW        60
     QGSELSYAVY QFFLNGGSKA IVVRVGEGVE YAGVDLKNGV KLKAKAPGAA GKKLKATVTL       120
     DANDNKRYTL LISDGTTSES YDVTIDPALR NRWLDRQLAT SQLVERDTET FDKRPDAVTD       180
     ESFTGGKDAT FTPAHVLGDA TKLPHTGLAA LADVEIFNLL VIPAQLAKPS GTDDRDTKWA       240
     PVVDAAVRLC EEQRAMLLLD PPFGWDSPET AVTGARAGMP VGGLAGRNAA VFFPKVVISD       300
     PLSGGNLEVG PAGTVAGVIA RTDTRRGVWK APAGTDDGGL LGVRSLAFRL SDQQNGTLNK       360
     LGVNCLRTVP VYGNVLWGSR TCRGGDAVSD PWKYIPVRRV ALHIEESLFI GTKWVVFEPN       420
     DEPLWSSIRL NIGAFMNRLF RQGAFQGPTA KGAYFVRCDA SNNPQDDIND GIVTIDVGFQ       480
     PLSPAEFVHI RIQQKRDDAT AQGS                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page