(data stored in ACNUC7421 zone)

EMBL: BA000030.PE385

BA000030.PE385       Location/Qualifiers
FT   CDS             454732..455262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_382"
FT                   /old_locus_tag="SAV_382"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_382"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68091"
FT                   /db_xref="GOA:Q82QW3"
FT                   /db_xref="InterPro:IPR010667"
FT                   /db_xref="InterPro:IPR011747"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QW3"
FT                   /protein_id="BAC68091.1"
FT                   /translation="MAQFTVNAARLDPYKNFKFRVKWDNRYVAGISKVSALKRTTEVVE
FT                   HRDGGDHSSARKSPGRTKYEPITLERGVTHDPEFEAWANKVWNYANAQAAPDQRDREVS
FT                   LAGFRKDLVIEVYNEAGQKVLAYQVFRCWVSEYQALPDLDANANAVAIQQLKLENEGWL
FT                   REASVTEPGEPSF"
     MAQFTVNAAR LDPYKNFKFR VKWDNRYVAG ISKVSALKRT TEVVEHRDGG DHSSARKSPG        60
     RTKYEPITLE RGVTHDPEFE AWANKVWNYA NAQAAPDQRD REVSLAGFRK DLVIEVYNEA       120
     GQKVLAYQVF RCWVSEYQAL PDLDANANAV AIQQLKLENE GWLREASVTE PGEPSF           176
//

If you have problems or comments...

PBIL Back to PBIL home page