(data stored in ACNUC7421 zone)

EMBL: BA000030.PE394

BA000030.PE394       Location/Qualifiers
FT   CDS             462705..463295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_391"
FT                   /old_locus_tag="SAV_391"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_391"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68100"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QV4"
FT                   /protein_id="BAC68100.1"
FT                   /translation="MTNMDDIGYVESPGFFSPAQREDAEPPGARRFYGKYRGSVVNNVD
FT                   PLGTGRLLVSVPDVFGLFPTSWAMPCVPLGGLQSGMFVRPPQQAGVWVEFEGGNPDHPI
FT                   WTGFFWGGRAETPATAGTLVPGSPVFLVETSGKSKIAVSDSPVTPMKGGGVLLQSPSAS
FT                   ITVDSAGVTITAANISLNGLVDINNGALVVKTA"
     MTNMDDIGYV ESPGFFSPAQ REDAEPPGAR RFYGKYRGSV VNNVDPLGTG RLLVSVPDVF        60
     GLFPTSWAMP CVPLGGLQSG MFVRPPQQAG VWVEFEGGNP DHPIWTGFFW GGRAETPATA       120
     GTLVPGSPVF LVETSGKSKI AVSDSPVTPM KGGGVLLQSP SASITVDSAG VTITAANISL       180
     NGLVDINNGA LVVKTA                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page