(data stored in ACNUC7421 zone)

EMBL: BA000030.PE395

BA000030.PE395       Location/Qualifiers
FT   CDS             463306..463653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_392"
FT                   /old_locus_tag="SAV_392"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_392"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68101"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QV3"
FT                   /protein_id="BAC68101.1"
FT                   /translation="MPGFALTTAAALTCAHQGQLTLTPGQQQVLAGGAPVVTTADVNVV
FT                   APSCVLSSSTPPTPCVKVDFSLAASTRVFVQGRPLVVQPAGPGTGLGLSAAQVSQGPPV
FT                   VSTVQQRVVAA"
     MPGFALTTAA ALTCAHQGQL TLTPGQQQVL AGGAPVVTTA DVNVVAPSCV LSSSTPPTPC        60
     VKVDFSLAAS TRVFVQGRPL VVQPAGPGTG LGLSAAQVSQ GPPVVSTVQQ RVVAA            115
//

If you have problems or comments...

PBIL Back to PBIL home page