(data stored in ACNUC7421 zone)

EMBL: BA000030.PE396

BA000030.PE396       Location/Qualifiers
FT   CDS             463650..464039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_393"
FT                   /old_locus_tag="SAV_393"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_393"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68102"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR040471"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QV2"
FT                   /protein_id="BAC68102.1"
FT                   /translation="MSAHPDYARTHLDFPFHVDARGRSAGTSDEGHVRDLIEQLLFTVP
FT                   GERVNRPDFGSGVLQLVFAPGGQELAGAVEYSLQASLQRWLTDVIQVERVEVEAEEAEL
FT                   RITVGYVLLATGEPGTAVVERGTGP"
     MSAHPDYART HLDFPFHVDA RGRSAGTSDE GHVRDLIEQL LFTVPGERVN RPDFGSGVLQ        60
     LVFAPGGQEL AGAVEYSLQA SLQRWLTDVI QVERVEVEAE EAELRITVGY VLLATGEPGT       120
     AVVERGTGP                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page