(data stored in ACNUC7421 zone)

EMBL: BA000030.PE397

BA000030.PE397       Location/Qualifiers
FT   CDS             464036..466855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_394"
FT                   /old_locus_tag="SAV_394"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_394"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68103"
FT                   /db_xref="InterPro:IPR006949"
FT                   /db_xref="InterPro:IPR011749"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QV1"
FT                   /protein_id="BAC68103.1"
FT                   /translation="MTGVPDTRPCLPGERADRTRESGLGAVVAVDVDAPGRTLRVLLLG
FT                   AAPDPVPGAECVRIEGPGRAVRAVSVRVEGSPPPTRRATLLVTVDRLGDRSPYTLRLVD
FT                   PDRPGAPFPGFDPRHSGAEFTFTADCAEEADCAAVADSPVPATPVPALDYLVKDYASFR
FT                   RLILDRLSLVSPAWADREVPDLGITLVELLAYVGDQLSYRQDAVATEAYLHTARLRTSV
FT                   RRHLRLVDHRLHEGCNARTWVHLAAEEPAVLRAGTYWFATALPGVRPLVSEAQLRGATT
FT                   YFERYEPVVAADLVLRPAHNEIRLWTWDGEECRLPAGTTSATLVDPGTGKERELELAPG
FT                   DVLVLEEVRGPVTGVPGDADPRHRQAVRLTDVEEITDPVRGQRLLRVVWAEEDALAFPL
FT                   CLATVGGERCCLFEDVSVARGNIVLVDQGSSGTPPLRLTAPTTATGPASCDDLGRPRPR
FT                   TEAPLRWLPRLDTGPLTRRSPHPDPARTAAAQVRALEGIPARAAEAVADMYRRASAPPT
FT                   DADLALARTLWGARAVADAGLETARDAAQRRAALTLLRARSAALLARRTARLTRLAARA
FT                   RAGVPLDTDTAAEVAAGWGPVLAAGLDPGDPRVAGPASAALVQDPRAALPQLTLTSAGE
FT                   HWEVRADLLDSDSDDPHVVVEAEDDGTARLRFGDGQLGRAVTGGQEFLAAVRVGNGPAG
FT                   IAGSGTVVHVVVSAPTDARVTAVRNPLPATGGTAPEPVADARLFGPTQYRHRLERAVTA
FT                   DDYSALAGEPAGVQRAATDLAWNGSWYEADVAVDALGRVDPPAALLDAVRDRLERGRRI
FT                   GHDLRVDAPRTVAVEVRLQLCLAPDARRAAVERAVRARLGNGVGGLFHPDRLTFDSDLY
FT                   PGRLVAEAMAVPGVVAAAVERLGRAEAPLPLVPDDGVLAFGPLEIPAGGADPSGPGAGV
FT                   LWIDLAGGR"
     MTGVPDTRPC LPGERADRTR ESGLGAVVAV DVDAPGRTLR VLLLGAAPDP VPGAECVRIE        60
     GPGRAVRAVS VRVEGSPPPT RRATLLVTVD RLGDRSPYTL RLVDPDRPGA PFPGFDPRHS       120
     GAEFTFTADC AEEADCAAVA DSPVPATPVP ALDYLVKDYA SFRRLILDRL SLVSPAWADR       180
     EVPDLGITLV ELLAYVGDQL SYRQDAVATE AYLHTARLRT SVRRHLRLVD HRLHEGCNAR       240
     TWVHLAAEEP AVLRAGTYWF ATALPGVRPL VSEAQLRGAT TYFERYEPVV AADLVLRPAH       300
     NEIRLWTWDG EECRLPAGTT SATLVDPGTG KERELELAPG DVLVLEEVRG PVTGVPGDAD       360
     PRHRQAVRLT DVEEITDPVR GQRLLRVVWA EEDALAFPLC LATVGGERCC LFEDVSVARG       420
     NIVLVDQGSS GTPPLRLTAP TTATGPASCD DLGRPRPRTE APLRWLPRLD TGPLTRRSPH       480
     PDPARTAAAQ VRALEGIPAR AAEAVADMYR RASAPPTDAD LALARTLWGA RAVADAGLET       540
     ARDAAQRRAA LTLLRARSAA LLARRTARLT RLAARARAGV PLDTDTAAEV AAGWGPVLAA       600
     GLDPGDPRVA GPASAALVQD PRAALPQLTL TSAGEHWEVR ADLLDSDSDD PHVVVEAEDD       660
     GTARLRFGDG QLGRAVTGGQ EFLAAVRVGN GPAGIAGSGT VVHVVVSAPT DARVTAVRNP       720
     LPATGGTAPE PVADARLFGP TQYRHRLERA VTADDYSALA GEPAGVQRAA TDLAWNGSWY       780
     EADVAVDALG RVDPPAALLD AVRDRLERGR RIGHDLRVDA PRTVAVEVRL QLCLAPDARR       840
     AAVERAVRAR LGNGVGGLFH PDRLTFDSDL YPGRLVAEAM AVPGVVAAAV ERLGRAEAPL       900
     PLVPDDGVLA FGPLEIPAGG ADPSGPGAGV LWIDLAGGR                              939
//

If you have problems or comments...

PBIL Back to PBIL home page