(data stored in ACNUC7421 zone)

EMBL: BA000030.PE40

BA000030.PE40        Location/Qualifiers
FT   CDS             complement(49694..50434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_40"
FT                   /old_locus_tag="SAV_40"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_40"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67749"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RV3"
FT                   /protein_id="BAC67749.1"
FT                   /translation="MYPNARGAAFGTPRRPPPHDGPGAKTPGPLLSDPAAGPSCPRLGG
FT                   GRGGHKCAFGTRAGTGQEQPHTDQKRKTHMNRKSSAHRRPGRRAAVAAGLVLAVGLGVS
FT                   TQVSAQAAVHAPAKASTAQSVSGTPGQAVTRVADFYGAYIDAKGDYTDPDATLATALRN
FT                   HYLTPDFAKRLAAWEKTNAADGVLRAQNIPAQWTATDNGTVGNGHEVIVTLTFGSGETT
FT                   QKTKLFVLVERYNHIVDIDTTSTR"
     MYPNARGAAF GTPRRPPPHD GPGAKTPGPL LSDPAAGPSC PRLGGGRGGH KCAFGTRAGT        60
     GQEQPHTDQK RKTHMNRKSS AHRRPGRRAA VAAGLVLAVG LGVSTQVSAQ AAVHAPAKAS       120
     TAQSVSGTPG QAVTRVADFY GAYIDAKGDY TDPDATLATA LRNHYLTPDF AKRLAAWEKT       180
     NAADGVLRAQ NIPAQWTATD NGTVGNGHEV IVTLTFGSGE TTQKTKLFVL VERYNHIVDI       240
     DTTSTR                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page