(data stored in ACNUC7421 zone)

EMBL: BA000030.PE401

BA000030.PE401       Location/Qualifiers
FT   CDS             472897..474789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_398"
FT                   /old_locus_tag="SAV_398"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_398"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68107"
FT                   /db_xref="InterPro:IPR025295"
FT                   /db_xref="InterPro:IPR028915"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QU7"
FT                   /protein_id="BAC68107.1"
FT                   /translation="MIRALIDRGRTGHDAAAVLHSRGHPLDAGIRQTMEMAFGHDFSQV
FT                   RVHSDPQAHALTRRMNARALTLGDHIALGQDWYSPDSADELRALAHELAHVVQQRSGCA
FT                   EPPAPSPHTETEHEAVAAADTVMGGGAARVRGRTGIGVARQAVESDPSDLSDTQLEQEW
FT                   LLAAAWLVDHSMLESDYFTVAKYVKSLEDAMRGRAGGAHRAQSEGTLPLEPLRPSILQV
FT                   PLRSPVGAAGSSGAVPAAPRPVVATPLDIPAEGVDMPWVGRGKGISSSELGYLRDSKYF
FT                   WPRFQQSYGSAISLANAQLIASGQAPRVDATWIEHFPGHAAYVNDTLEHHHVGQGSRAV
FT                   PLPSRLHDAYTVFHPQRRVVSTPQGGLRPIPPPRSHADAQTNLNSHVEAGRISGPGIDP
FT                   TKPPTVPAVPPASEVAGQRATPPAAVPRMFGGGRIRGLVGGTILGGLQLLAGYLSAKLQ
FT                   DHFDQQRWERERETIQAQVERELDGMSLEITDRYLDAPGREVFAVVAITSTALRTVQVY
FT                   ATGIQSEVVDQTVYLGSKLASVELGSAARSERHEEVRQIAAPLNLGFPTTTYTTTTLYS
FT                   FAVPSPDLIALRWRALERLRDLDLQAPASQTAQAAAAVQEERTRLSAWLRPSAD"
     MIRALIDRGR TGHDAAAVLH SRGHPLDAGI RQTMEMAFGH DFSQVRVHSD PQAHALTRRM        60
     NARALTLGDH IALGQDWYSP DSADELRALA HELAHVVQQR SGCAEPPAPS PHTETEHEAV       120
     AAADTVMGGG AARVRGRTGI GVARQAVESD PSDLSDTQLE QEWLLAAAWL VDHSMLESDY       180
     FTVAKYVKSL EDAMRGRAGG AHRAQSEGTL PLEPLRPSIL QVPLRSPVGA AGSSGAVPAA       240
     PRPVVATPLD IPAEGVDMPW VGRGKGISSS ELGYLRDSKY FWPRFQQSYG SAISLANAQL       300
     IASGQAPRVD ATWIEHFPGH AAYVNDTLEH HHVGQGSRAV PLPSRLHDAY TVFHPQRRVV       360
     STPQGGLRPI PPPRSHADAQ TNLNSHVEAG RISGPGIDPT KPPTVPAVPP ASEVAGQRAT       420
     PPAAVPRMFG GGRIRGLVGG TILGGLQLLA GYLSAKLQDH FDQQRWERER ETIQAQVERE       480
     LDGMSLEITD RYLDAPGREV FAVVAITSTA LRTVQVYATG IQSEVVDQTV YLGSKLASVE       540
     LGSAARSERH EEVRQIAAPL NLGFPTTTYT TTTLYSFAVP SPDLIALRWR ALERLRDLDL       600
     QAPASQTAQA AAAVQEERTR LSAWLRPSAD                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page