(data stored in ACNUC7421 zone)

EMBL: BA000030.PE402

BA000030.PE402       Location/Qualifiers
FT   CDS             complement(474824..475045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_399"
FT                   /old_locus_tag="SAV_399"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_399"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68108"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QU6"
FT                   /protein_id="BAC68108.1"
FT                   /translation="MSETPETPTAVLLITVWFEPASPTLRARVIQAVDVHTPGETMVLV
FT                   GRDAVLGVVHEWLDACAHDRPNPPSGAT"
     MSETPETPTA VLLITVWFEP ASPTLRARVI QAVDVHTPGE TMVLVGRDAV LGVVHEWLDA        60
     CAHDRPNPPS GAT                                                           73
//

If you have problems or comments...

PBIL Back to PBIL home page