(data stored in ACNUC7421 zone)

EMBL: BA000030.PE42

BA000030.PE42        Location/Qualifiers
FT   CDS             51232..52623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_42"
FT                   /old_locus_tag="SAV_42"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_42"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67751"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RV1"
FT                   /protein_id="BAC67751.1"
FT                   /translation="MPGIRDRGRDDGGTVSMRDDVEEFAALLRQLKDRTDRSYGSLARR
FT                   LNMNTSTLHRYCAGEAVPQDFAPVERLAAFCEATPKERLELHRLWLLAVEARQRVRTAG
FT                   PAEAAVSAEAAVPAPDTDGALAEDGEPAEESCSAEQPGDGPGPDEPAPSPAPRPWFRRR
FT                   RVLASTSVTCALLAALGTTSALSDDRSSEADGSRSAGPRAAAPGASHRSAKPSAGGSPS
FT                   PSRSFAAPGPRQKAPAPSGTGSGPTPAAKPATGLPLAWSADSLVWDKGCDHDYVIDKPP
FT                   AQVPPPPVQQDAGAWAATQGAVHGRHTMVQISVQGQSSTAVVLKALHVRIVSRGNPAAG
FT                   SAYAMGQGCGGDLTPRRFTVNLDAGRPIARPKDGADIGHTIPAVQFPYRVSAEDPEVLL
FT                   VDATTQAYNARWYLELDWSSQGRTGTIRIDDHGRPFHTTSIKGMPRYWYGTNNAGGRAW
FT                   VPYDS"
     MPGIRDRGRD DGGTVSMRDD VEEFAALLRQ LKDRTDRSYG SLARRLNMNT STLHRYCAGE        60
     AVPQDFAPVE RLAAFCEATP KERLELHRLW LLAVEARQRV RTAGPAEAAV SAEAAVPAPD       120
     TDGALAEDGE PAEESCSAEQ PGDGPGPDEP APSPAPRPWF RRRRVLASTS VTCALLAALG       180
     TTSALSDDRS SEADGSRSAG PRAAAPGASH RSAKPSAGGS PSPSRSFAAP GPRQKAPAPS       240
     GTGSGPTPAA KPATGLPLAW SADSLVWDKG CDHDYVIDKP PAQVPPPPVQ QDAGAWAATQ       300
     GAVHGRHTMV QISVQGQSST AVVLKALHVR IVSRGNPAAG SAYAMGQGCG GDLTPRRFTV       360
     NLDAGRPIAR PKDGADIGHT IPAVQFPYRV SAEDPEVLLV DATTQAYNAR WYLELDWSSQ       420
     GRTGTIRIDD HGRPFHTTSI KGMPRYWYGT NNAGGRAWVP YDS                         463
//

If you have problems or comments...

PBIL Back to PBIL home page