(data stored in ACNUC7421 zone)

EMBL: BA000030.PE432

BA000030.PE432       Location/Qualifiers
FT   CDS             complement(576830..577165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_427"
FT                   /old_locus_tag="SAV_427"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_427"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68137"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QS8"
FT                   /protein_id="BAC68137.1"
FT                   /translation="MSGAPQFLPSQSLPEVPYADFARSLGLGGVRVEKPGDVESAWRQA
FT                   LACDRPFVLDFRTDPAVPPIPPHATLEQIEAAATAILEGDSDRAGVVKQGFKAKVQEML
FT                   PGGHRNK"
     MSGAPQFLPS QSLPEVPYAD FARSLGLGGV RVEKPGDVES AWRQALACDR PFVLDFRTDP        60
     AVPPIPPHAT LEQIEAAATA ILEGDSDRAG VVKQGFKAKV QEMLPGGHRN K                111
//

If you have problems or comments...

PBIL Back to PBIL home page