(data stored in ACNUC7421 zone)

EMBL: BA000030.PE440

BA000030.PE440       Location/Qualifiers
FT   CDS             585449..585874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_435"
FT                   /old_locus_tag="SAV_435"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_435"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68145"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QS0"
FT                   /protein_id="BAC68145.1"
FT                   /translation="MPMGAADPALRPRRQGLLRPDACACGDPLPSIKVRGRVADLLSFP
FT                   RRGGGTVRIVPMAFETLLESIPDIDLFQIVQTSPTTLRVRIRSTTGADRERLWTAVRQE
FT                   LAALLGAHGADQVSVERAHEPPEQSPGGKYRVVMPHS"
     MPMGAADPAL RPRRQGLLRP DACACGDPLP SIKVRGRVAD LLSFPRRGGG TVRIVPMAFE        60
     TLLESIPDID LFQIVQTSPT TLRVRIRSTT GADRERLWTA VRQELAALLG AHGADQVSVE       120
     RAHEPPEQSP GGKYRVVMPH S                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page