(data stored in ACNUC7421 zone)

EMBL: BA000030.PE443

BA000030.PE443       Location/Qualifiers
FT   CDS             complement(590678..591778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_438"
FT                   /old_locus_tag="SAV_438"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_438"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68148"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR021276"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QR7"
FT                   /protein_id="BAC68148.1"
FT                   /translation="MDTTTTTATAAAVGWNLLIARDDLSIAELADAPVPEVRDGEALLR
FT                   VDQVGLTANNVTYAALGDSFRYWQFFPASREGWGIVPLWGFAEVVDSRVEGIEPGSRYY
FT                   GYLPSASHLLVRPGRVDERGFRDASPHRQTLPRPYNAYALTTGDLAYEADREDLQILYR
FT                   PLFWTSFMLADWLVDNAWLGAATAVLSSASSKTAYGAAFLLQGRGCEIVGLTSRRNVAF
FT                   TESLGCYDRVLAYEDVVQLPNRPTLYADFAGDERLTASLSAHLGDALVHHVVVGITNQE
FT                   PGPAGTLAETGPGMFFAPDQMRKRTGEWGRAGLDRRFADAWQRFAPVAEGWVDVVHGQG
FT                   PQALTQVWREVQSGRTAPRTGHVVIF"
     MDTTTTTATA AAVGWNLLIA RDDLSIAELA DAPVPEVRDG EALLRVDQVG LTANNVTYAA        60
     LGDSFRYWQF FPASREGWGI VPLWGFAEVV DSRVEGIEPG SRYYGYLPSA SHLLVRPGRV       120
     DERGFRDASP HRQTLPRPYN AYALTTGDLA YEADREDLQI LYRPLFWTSF MLADWLVDNA       180
     WLGAATAVLS SASSKTAYGA AFLLQGRGCE IVGLTSRRNV AFTESLGCYD RVLAYEDVVQ       240
     LPNRPTLYAD FAGDERLTAS LSAHLGDALV HHVVVGITNQ EPGPAGTLAE TGPGMFFAPD       300
     QMRKRTGEWG RAGLDRRFAD AWQRFAPVAE GWVDVVHGQG PQALTQVWRE VQSGRTAPRT       360
     GHVVIF                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page