(data stored in ACNUC7421 zone)

EMBL: BA000030.PE444

BA000030.PE444       Location/Qualifiers
FT   CDS             complement(592072..592773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_439"
FT                   /old_locus_tag="SAV_439"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_439"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68149"
FT                   /db_xref="InterPro:IPR018713"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QR6"
FT                   /protein_id="BAC68149.1"
FT                   /translation="MADRVGGVAAAGSADCRSGGRRRHDNFSTYRAHPWRRSEHTMDSG
FT                   KRLFFSDREGLRREVARLERTHRRLAGTDEQGRPFTALDPAVRVWVLVTLYECMTAMRE
FT                   LSGRPLAPPELDQIYGEFRAVCTEFGLSDDLFPVTAADVPAYMDRTIRERLEYSEPVRY
FT                   LLFDMLREAPAPRRLGHLKPAWPLVRTVAAHVIGALTIADLPEAFRERFSPPRTRRAAL
FT                   LSLILHRGIAC"
     MADRVGGVAA AGSADCRSGG RRRHDNFSTY RAHPWRRSEH TMDSGKRLFF SDREGLRREV        60
     ARLERTHRRL AGTDEQGRPF TALDPAVRVW VLVTLYECMT AMRELSGRPL APPELDQIYG       120
     EFRAVCTEFG LSDDLFPVTA ADVPAYMDRT IRERLEYSEP VRYLLFDMLR EAPAPRRLGH       180
     LKPAWPLVRT VAAHVIGALT IADLPEAFRE RFSPPRTRRA ALLSLILHRG IAC              233
//

If you have problems or comments...

PBIL Back to PBIL home page