(data stored in ACNUC7421 zone)

EMBL: BA000030.PE454

BA000030.PE454       Location/Qualifiers
FT   CDS             603569..603973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_449"
FT                   /old_locus_tag="SAV_449"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_449"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68159"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR013097"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QQ6"
FT                   /protein_id="BAC68159.1"
FT                   /translation="MIYHINRVTMKATATPEQIEGVLESWRNQGRSNPAIKSFVVGRNH
FT                   GGDYTYGAVFVVEHLDGLFAYLTHPTTYQTDHLGLHLVERLEIFDVSDDDDPDLNAKIQ
FT                   ELHRRRNELNPQIAGMLADVPTYTGSGVDD"
     MIYHINRVTM KATATPEQIE GVLESWRNQG RSNPAIKSFV VGRNHGGDYT YGAVFVVEHL        60
     DGLFAYLTHP TTYQTDHLGL HLVERLEIFD VSDDDDPDLN AKIQELHRRR NELNPQIAGM       120
     LADVPTYTGS GVDD                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page