(data stored in ACNUC7421 zone)

EMBL: BA000030.PE455

BA000030.PE455       Location/Qualifiers
FT   CDS             604002..604904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_450"
FT                   /old_locus_tag="SAV_450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_450"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68160"
FT                   /db_xref="GOA:Q82QQ5"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QQ5"
FT                   /protein_id="BAC68160.1"
FT                   /translation="MAKHVIIGAGSIGTNVARLLAEGGESVRIVTRSGSGPEHPLVDRV
FT                   AADASDPSRLTELSRGAGVIYHCANPPSYTVWERLLPPLQTAAITAAKANDAVLALTGS
FT                   LYAYGPQPGGRMNEHTPMAATGHKGRLRRRMWEQALAGGIRTVEVRGSDYIGKDANGIY
FT                   SLLIKSALQKGKAAWITGHLDMPHTFTFNGDMAQALITLASEERAWGRPWHVPSAPAVT
FT                   IRELARRYAVAAGRPPIKLIQIPRSVTRTAGLIVPIAREMAEMDYQWYAPFHMDATETT
FT                   ETFGLTATDLDTAVRNEVG"
     MAKHVIIGAG SIGTNVARLL AEGGESVRIV TRSGSGPEHP LVDRVAADAS DPSRLTELSR        60
     GAGVIYHCAN PPSYTVWERL LPPLQTAAIT AAKANDAVLA LTGSLYAYGP QPGGRMNEHT       120
     PMAATGHKGR LRRRMWEQAL AGGIRTVEVR GSDYIGKDAN GIYSLLIKSA LQKGKAAWIT       180
     GHLDMPHTFT FNGDMAQALI TLASEERAWG RPWHVPSAPA VTIRELARRY AVAAGRPPIK       240
     LIQIPRSVTR TAGLIVPIAR EMAEMDYQWY APFHMDATET TETFGLTATD LDTAVRNEVG       300
//

If you have problems or comments...

PBIL Back to PBIL home page