(data stored in ACNUC7421 zone)

EMBL: BA000030.PE458

BA000030.PE458       Location/Qualifiers
FT   CDS             606058..606540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_453"
FT                   /old_locus_tag="SAV_453"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_453"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68163"
FT                   /db_xref="InterPro:IPR018727"
FT                   /db_xref="InterPro:IPR038282"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QQ2"
FT                   /protein_id="BAC68163.1"
FT                   /translation="MVTAVRARARAGSAWQACRGARRSSQHSSEGVRRMDEKEFLRTVA
FT                   ERTGLSRQEAADLTWATLETLARRLSPGEARDLITELPEGLAEAVRRGTTDRIERFGHH
FT                   DSVRRVAERTMLKEEEADRGVRTVLAVLREAISEKEFNDLMSQLGTDFSQALESAG"
     MVTAVRARAR AGSAWQACRG ARRSSQHSSE GVRRMDEKEF LRTVAERTGL SRQEAADLTW        60
     ATLETLARRL SPGEARDLIT ELPEGLAEAV RRGTTDRIER FGHHDSVRRV AERTMLKEEE       120
     ADRGVRTVLA VLREAISEKE FNDLMSQLGT DFSQALESAG                             160
//

If you have problems or comments...

PBIL Back to PBIL home page