(data stored in ACNUC7421 zone)

EMBL: BA000030.PE459

BA000030.PE459       Location/Qualifiers
FT   CDS             606685..607839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_454"
FT                   /old_locus_tag="SAV_454"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_454"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68164"
FT                   /db_xref="GOA:Q82QQ1"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QQ1"
FT                   /protein_id="BAC68164.1"
FT                   /translation="MIMTADVPETSSGRSVRVALVADPGLPSEIARALAPRLPDHLRRA
FT                   VGARVRWQVDTMTAPLSVSEQADVSDIAEAVRSHLDGAEWDVAIFLTDFPRRARLYPIS
FT                   VEVDTALRAALISLPALGVRRLRRRVRQAVVDVVRELVAHEETPRHPEVIGRPPREPVP
FT                   DTRPGPEQPQRYVVPGLRGHTRLVAGMVYANRPWRLFGSLSRALAGVFATATVLFINSA
FT                   TWNLATALGAVQHAVITAGSAVALTLWIIVDHQLWERGTHLPARHHPLYPYNLVTLVTI
FT                   ALAVVVLAAALFATLVAVSFLLLDASVLRKFIGRQVGVGDYLFLAWFITAIAMIGGAFG
FT                   TSLEGDEKVSDAAYGRRQRERQRMLRQMPRPERGERRGPDTTDG"
     MIMTADVPET SSGRSVRVAL VADPGLPSEI ARALAPRLPD HLRRAVGARV RWQVDTMTAP        60
     LSVSEQADVS DIAEAVRSHL DGAEWDVAIF LTDFPRRARL YPISVEVDTA LRAALISLPA       120
     LGVRRLRRRV RQAVVDVVRE LVAHEETPRH PEVIGRPPRE PVPDTRPGPE QPQRYVVPGL       180
     RGHTRLVAGM VYANRPWRLF GSLSRALAGV FATATVLFIN SATWNLATAL GAVQHAVITA       240
     GSAVALTLWI IVDHQLWERG THLPARHHPL YPYNLVTLVT IALAVVVLAA ALFATLVAVS       300
     FLLLDASVLR KFIGRQVGVG DYLFLAWFIT AIAMIGGAFG TSLEGDEKVS DAAYGRRQRE       360
     RQRMLRQMPR PERGERRGPD TTDG                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page