(data stored in ACNUC7421 zone)

EMBL: BA000030.PE469

BA000030.PE469       Location/Qualifiers
FT   CDS             complement(615205..615528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_464"
FT                   /old_locus_tag="SAV_464"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_464"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68174"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QP1"
FT                   /protein_id="BAC68174.1"
FT                   /translation="MLAAAGVLSMPLIWLLDSPDAGQLVGASIQAAVGVAALIGALFQH
FT                   PASRTDDTAARTGVARASGGGTAVTGVECPQGRGSGSAQTERTGNATAGGDGSSAVSSI
FT                   DYT"
     MLAAAGVLSM PLIWLLDSPD AGQLVGASIQ AAVGVAALIG ALFQHPASRT DDTAARTGVA        60
     RASGGGTAVT GVECPQGRGS GSAQTERTGN ATAGGDGSSA VSSIDYT                     107
//

If you have problems or comments...

PBIL Back to PBIL home page