(data stored in ACNUC7421 zone)

EMBL: BA000030.PE48

BA000030.PE48        Location/Qualifiers
FT   CDS             complement(58168..58824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_48"
FT                   /old_locus_tag="SAV_48"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_48"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67757"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RU5"
FT                   /protein_id="BAC67757.1"
FT                   /translation="MPSNNSSLRPMALRPDEFYAHARTAADGERRLPLARMTGWDISPF
FT                   EADGLRVAPLRPPVLPEPARHGEDPLDCNACRSRDEGIWLDDRWRLTRITGVGVPLVLM
FT                   LHPRDHFDLADLPDELAAELGVLTTHIARHVQALPHISRAHVYRIGDGGAHLHIWFFAR
FT                   PEGQAQLYGSWMVIWDDLLPEYPADAAEADAAIVADALVASYGGRRPAVSELPHA"
     MPSNNSSLRP MALRPDEFYA HARTAADGER RLPLARMTGW DISPFEADGL RVAPLRPPVL        60
     PEPARHGEDP LDCNACRSRD EGIWLDDRWR LTRITGVGVP LVLMLHPRDH FDLADLPDEL       120
     AAELGVLTTH IARHVQALPH ISRAHVYRIG DGGAHLHIWF FARPEGQAQL YGSWMVIWDD       180
     LLPEYPADAA EADAAIVADA LVASYGGRRP AVSELPHA                               218
//

If you have problems or comments...

PBIL Back to PBIL home page