(data stored in ACNUC7421 zone)

EMBL: BA000030.PE483

BA000030.PE483       Location/Qualifiers
FT   CDS             629473..629790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_478"
FT                   /old_locus_tag="SAV_478"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_478"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68188"
FT                   /db_xref="GOA:Q82QM7"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QM7"
FT                   /protein_id="BAC68188.1"
FT                   /translation="MTLLSNVPHPLAEALDLSAWCSTLMTRTVYSARLGVNKPDPRAYE
FT                   AAVVAAGLPHPENTLFVDDRLENCAVAAQLGLRTLHFNGDSQALASHIPQMVPATGIRR
FT                   N"
     MTLLSNVPHP LAEALDLSAW CSTLMTRTVY SARLGVNKPD PRAYEAAVVA AGLPHPENTL        60
     FVDDRLENCA VAAQLGLRTL HFNGDSQALA SHIPQMVPAT GIRRN                       105
//

If you have problems or comments...

PBIL Back to PBIL home page