(data stored in ACNUC7421 zone)

EMBL: BA000030.PE487

BA000030.PE487       Location/Qualifiers
FT   CDS             631222..631539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_481"
FT                   /old_locus_tag="SAV_481"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_481"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68192"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QM3"
FT                   /protein_id="BAC68192.1"
FT                   /translation="MAGQCALPPPLPGVPSYKNAVSRQAARRSLPGSPSTPWRCWRPHR
FT                   RGHCRRWSSTGTHDYVVVFDADTDAVPVFTALGRWVGMAESSGTIGTLTEIHERVNGGD
FT                   A"
     MAGQCALPPP LPGVPSYKNA VSRQAARRSL PGSPSTPWRC WRPHRRGHCR RWSSTGTHDY        60
     VVVFDADTDA VPVFTALGRW VGMAESSGTI GTLTEIHERV NGGDA                       105
//

If you have problems or comments...

PBIL Back to PBIL home page