(data stored in ACNUC7421 zone)

EMBL: BA000030.PE49

BA000030.PE49        Location/Qualifiers
FT   CDS             58919..59212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_49"
FT                   /old_locus_tag="SAV_49"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_49"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67758"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RU4"
FT                   /protein_id="BAC67758.1"
FT                   /translation="MEWWWRRTGCWRSTTPGRRIPFTSWWFPRDHAPSLIDFGAGGEEL
FT                   LAEVIRVVRTVAAQVEQQHGACSVMTNLGLYRESKHQHWHVVHRGEPRTEVP"
     MEWWWRRTGC WRSTTPGRRI PFTSWWFPRD HAPSLIDFGA GGEELLAEVI RVVRTVAAQV        60
     EQQHGACSVM TNLGLYRESK HQHWHVVHRG EPRTEVP                                 97
//

If you have problems or comments...

PBIL Back to PBIL home page