(data stored in ACNUC7421 zone)

EMBL: BA000030.PE492

BA000030.PE492       Location/Qualifiers
FT   CDS             complement(633937..634218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_487"
FT                   /old_locus_tag="SAV_487"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_487"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68197"
FT                   /db_xref="UniProtKB/TrEMBL:Q82QL8"
FT                   /protein_id="BAC68197.1"
FT                   /translation="MRTSIRIASVLAGRPLALGGVAFTAPPPTRTSRPASTRSSGSCRA
FT                   GRALSSDELHYEERWEPNHPATTVRTWTGVFAWSVISGLIGEPHRVTG"
     MRTSIRIASV LAGRPLALGG VAFTAPPPTR TSRPASTRSS GSCRAGRALS SDELHYEERW        60
     EPNHPATTVR TWTGVFAWSV ISGLIGEPHR VTG                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page